Product Certification&
    Enterprise Certification

  • Ms.Alison
    Tel: +86-371-56100691

  • Mr.Kevin Wang
    Sales manager
    Tel: +86-371-56100691

  • Ms.Aria
    sales manager
    Tel: 0371-56100691

  • Ms.Wendy
    sales manager
    Tel: 0371-56100691

  • Mr.Doudou
    Tel: 0371-56100691

  • Mr.Kyson
    Tel: 0371-63339395

  • Mr.Phil
    Tel: 15238027789

  • Mobile:+86 13503833127
  • Tel:+86-371-56100691
  • Fax:
  • URL:http://www.wisingchem.com
  • Province/state:Henan
  • City:Zhengzhou
  • Street:Jinshui District
  • MaxCard:
Home > Products >  AMYLIN, HUMAN

AMYLIN, HUMAN CAS NO.122384-88-7

  • Min.Order: 5 Gram
  • Payment Terms: L/C,T/T,
  • Product Details

Keywords

  • KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 (DISULFIDE BRIDGE
  • DIABETES-ASSOCIATED PEPTIDE HUMAN
  • DAP AMIDE, HUMAN

Quick Details

  • ProName: AMYLIN, HUMAN
  • CasNo: 122384-88-7
  • Molecular Formula: C8H17O3*
  • Application: Used as Pharmaceutical intermediates
  • DeliveryTime: Within 1-2 weeks after confirm the ord...
  • PackAge: as the customer's needs
  • Port: Any port of China
  • ProductionCapacity: 10 Kilogram/Month
  • Purity: 95%Min
  • Transportation: by sea or by air
  • LimitNum: 5 Gram

Superiority


Henan Wising Chem specializes in sourcing chemicals in China. We are associated with many trusted manufacturers each having different areas of expertise required for meeting the needs of our local as well as overseas buyers. We have access to custom synthesis labs for kilo level synthesis and quality confirmation. Following are our main products:

 

Pharmaceutical Intermediates/ UV Absorbent / Electronic Chemicals

 

 

If you have interest in any of our products, we can send you our best price with more product details.

Details


Henan Wising Chem specializes in sourcing chemicals in China. We are associated with many trusted manufacturers each having different areas of expertise required for meeting the needs of our local as well as overseas buyers. We have access to custom synthesis labs for kilo level synthesis and quality confirmation. Following are our main products:

 

Pharmaceutical Intermediates/ UV Absorbent / Electronic Chemicals

 

 

If you have interest in any of our products, we can send you our best price with more product details.

Other products of this supplier

lookchemhot product CAS New CAS Cas Database Article Data Chemical Catalog